(data stored in ACNUC7421 zone)

EMBL: AP010803.PE492

AP010803.PE492       Location/Qualifiers
FT   CDS             497764..498237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04920"
FT                   /product="hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95326"
FT                   /db_xref="GOA:D4YY94"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY94"
FT                   /protein_id="BAI95326.1"
FT                   /translation="MDHSSHMNTRKMGAYWSLAVQTVISGVIMYLVMFVMIDGLDSFYN
FT                   NLNMLYMTLMMVAPMVVLMILAMRHMFASKAANIALIAASLVAFFGSFALIRTQTTIGD
FT                   TAFLRSMIPHHSGAILMCQEAKLSDPEVIRLCESIKRSQRQEIDEMKAILARR"
     MDHSSHMNTR KMGAYWSLAV QTVISGVIMY LVMFVMIDGL DSFYNNLNML YMTLMMVAPM        60
     VVLMILAMRH MFASKAANIA LIAASLVAFF GSFALIRTQT TIGDTAFLRS MIPHHSGAIL       120
     MCQEAKLSDP EVIRLCESIK RSQRQEIDEM KAILARR                                157
//

If you have problems or comments...

PBIL Back to PBIL home page