(data stored in ACNUC7421 zone)

EMBL: AP010803.PE493

AP010803.PE493       Location/Qualifiers
FT   CDS             498296..499831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04930"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95327"
FT                   /db_xref="GOA:D4YY95"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY95"
FT                   /protein_id="BAI95327.1"
FT                   /translation="MVDTRRGADEIASDVARLAPLFLRQAGGHVLTLLDPSGIVLSYNE
FT                   EGERAECWPLDRVLGQPHDLFYPPDEIAAGRPGADLAAALHEGTLEREAWRVCENGAEY
FT                   LARLTITALFEGDTHRGFACISRDVTDEAAVRASIETREQHLQSILATVPDAMIIIDET
FT                   GAITSFSAAAQRLFGYSEAELVGRNVSCLMPQPDRDRHDEYLAHYLQTGERRIIGLGRV
FT                   VVGQRRDGSTFPMQLSVGEAGEDGQRLFTGFIRDLTAKEQDELRLKELQAELVHVSRLS
FT                   AMGTMASTLAHELNQPLAAVALYLETIRDMLDERDDEPFVSLRSVMDDAAQETLRAGHI
FT                   VRRLRDFVARGEVDKSLHELPQVIAEASQLALVGARERGIRSFFAVDPAATPVLVDRVQ
FT                   IQQVLVNLMRNAIEAMAECPVRDLKVATRLRPDGLIEVTVEDTGPGIADGIREQLFTAF
FT                   NSTKADGMGLGLSICRTIIEAHGGRIWMERPDRGGTRFHFTLIHARAEEEHGG"
     MVDTRRGADE IASDVARLAP LFLRQAGGHV LTLLDPSGIV LSYNEEGERA ECWPLDRVLG        60
     QPHDLFYPPD EIAAGRPGAD LAAALHEGTL EREAWRVCEN GAEYLARLTI TALFEGDTHR       120
     GFACISRDVT DEAAVRASIE TREQHLQSIL ATVPDAMIII DETGAITSFS AAAQRLFGYS       180
     EAELVGRNVS CLMPQPDRDR HDEYLAHYLQ TGERRIIGLG RVVVGQRRDG STFPMQLSVG       240
     EAGEDGQRLF TGFIRDLTAK EQDELRLKEL QAELVHVSRL SAMGTMASTL AHELNQPLAA       300
     VALYLETIRD MLDERDDEPF VSLRSVMDDA AQETLRAGHI VRRLRDFVAR GEVDKSLHEL       360
     PQVIAEASQL ALVGARERGI RSFFAVDPAA TPVLVDRVQI QQVLVNLMRN AIEAMAECPV       420
     RDLKVATRLR PDGLIEVTVE DTGPGIADGI REQLFTAFNS TKADGMGLGL SICRTIIEAH       480
     GGRIWMERPD RGGTRFHFTL IHARAEEEHG G                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page