(data stored in ACNUC7421 zone)

EMBL: AP010803.PE495

AP010803.PE495       Location/Qualifiers
FT   CDS             500526..500933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04950"
FT                   /product="CheY-like response regulator"
FT                   /note="response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95329"
FT                   /db_xref="GOA:D4YY97"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY97"
FT                   /protein_id="BAI95329.1"
FT                   /translation="MPSVRSTQHDGRYTILVSDDDPGVRRGLQLLLRSRGYAVWGYTTG
FT                   HALLADPRAKEADCVILDYRMPDIDGFAMLRHLREIGWSGRAIMISGFHDTLLASRAAE
FT                   AGFDHVLAKPLIGRALLDALDRHRAETLRKH"
     MPSVRSTQHD GRYTILVSDD DPGVRRGLQL LLRSRGYAVW GYTTGHALLA DPRAKEADCV        60
     ILDYRMPDID GFAMLRHLRE IGWSGRAIMI SGFHDTLLAS RAAEAGFDHV LAKPLIGRAL       120
     LDALDRHRAE TLRKH                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page