(data stored in ACNUC7421 zone)

EMBL: AP010803.PE499

AP010803.PE499       Location/Qualifiers
FT   CDS             505844..506632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04990"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95333"
FT                   /db_xref="GOA:D4YYA1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA1"
FT                   /protein_id="BAI95333.1"
FT                   /translation="MKPLPIQNSWVLVTGASTGLGRASALRLAASYQAKPLIVGRRLDN
FT                   LRELQSEIGERFNVPCEIIVADQREIEGREKIAAKVIELKVNAAFLAAGLTSAGPFDAS
FT                   RADAYAEVIGTNVAGFTDLLARLIAIFRQQPFESSIIAVSSLAGETSVPFQAVYGASKA
FT                   YVSTLMRALSIELAGTGVSVGSFAPGGIDTDMAALSDLKWGKLGLMNVDRCATLAVDAL
FT                   VHRRSFAIPGMGNRLTYLASRALPRSLVSRLAALPYRRPQ"
     MKPLPIQNSW VLVTGASTGL GRASALRLAA SYQAKPLIVG RRLDNLRELQ SEIGERFNVP        60
     CEIIVADQRE IEGREKIAAK VIELKVNAAF LAAGLTSAGP FDASRADAYA EVIGTNVAGF       120
     TDLLARLIAI FRQQPFESSI IAVSSLAGET SVPFQAVYGA SKAYVSTLMR ALSIELAGTG       180
     VSVGSFAPGG IDTDMAALSD LKWGKLGLMN VDRCATLAVD ALVHRRSFAI PGMGNRLTYL       240
     ASRALPRSLV SRLAALPYRR PQ                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page