(data stored in SCRATCH zone)

EMBL: AP010803.PE50

AP010803.PE50        Location/Qualifiers
FT   CDS             complement(51627..52124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94884"
FT                   /db_xref="GOA:D4YX02"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX02"
FT                   /protein_id="BAI94884.1"
FT                   /translation="MLHQGLAPRLGLSFGMTVNLVGAIVLLLWWPLRQRPGLGTVCNIA
FT                   VIGTAVDISLLILPTPEGHAMRFAWLAAGILLNGIAGGAYIGAGLGPGPRDGLMTGFCR
FT                   RTGLPVKWVRTGIEIGVLAAGWLLGGTVGLGTLLYAATIGWIVHHALPFFAIAARERPA
FT                   PA"
     MLHQGLAPRL GLSFGMTVNL VGAIVLLLWW PLRQRPGLGT VCNIAVIGTA VDISLLILPT        60
     PEGHAMRFAW LAAGILLNGI AGGAYIGAGL GPGPRDGLMT GFCRRTGLPV KWVRTGIEIG       120
     VLAAGWLLGG TVGLGTLLYA ATIGWIVHHA LPFFAIAARE RPAPA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page