(data stored in ACNUC7421 zone)

EMBL: AP010803.PE500

AP010803.PE500       Location/Qualifiers
FT   CDS             complement(507031..507777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05000"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95334"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA2"
FT                   /protein_id="BAI95334.1"
FT                   /translation="MLPRATTTPMMAKDSMLEWLKSQIVRRNVTVKDDIAAVVARAQAR
FT                   RPVDILVNNAGGGVIGATEEMSDAEVEGQIALNLMAPIHITRAFVPAMRLRGSGRIIQI
FT                   SSASGQGSLPTSSLYHAAKWGLEGFSECLRQELEPFNLFVTLIEPGGARTSFSHNLQFA
FT                   SEIAAYRDTPAGDIRKMFETAGNELYTLDPQKIAQAIVDVATSDHPPLRVTLGGDAFGV
FT                   VQAALQSRLAFLQSQEALARSVAFDS"
     MLPRATTTPM MAKDSMLEWL KSQIVRRNVT VKDDIAAVVA RAQARRPVDI LVNNAGGGVI        60
     GATEEMSDAE VEGQIALNLM APIHITRAFV PAMRLRGSGR IIQISSASGQ GSLPTSSLYH       120
     AAKWGLEGFS ECLRQELEPF NLFVTLIEPG GARTSFSHNL QFASEIAAYR DTPAGDIRKM       180
     FETAGNELYT LDPQKIAQAI VDVATSDHPP LRVTLGGDAF GVVQAALQSR LAFLQSQEAL       240
     ARSVAFDS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page