(data stored in ACNUC7421 zone)

EMBL: AP010803.PE503

AP010803.PE503       Location/Qualifiers
FT   CDS             complement(509014..509451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05030"
FT                   /product="putative metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95337"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA5"
FT                   /protein_id="BAI95337.1"
FT                   /translation="MKTRLFVALLFLAMPGVALAASDIVVHRDPGCGCCEKWAQAVRAK
FT                   LGRKVVMRDDASRSELQRKAGMPRTLASCHSAIVDGYMIEGHVPISDVKRLLATRPAGV
FT                   KGIAVAGMPIGSEGMEVAGAARQPYTVVAFGSAGQRIFARH"
     MKTRLFVALL FLAMPGVALA ASDIVVHRDP GCGCCEKWAQ AVRAKLGRKV VMRDDASRSE        60
     LQRKAGMPRT LASCHSAIVD GYMIEGHVPI SDVKRLLATR PAGVKGIAVA GMPIGSEGME       120
     VAGAARQPYT VVAFGSAGQR IFARH                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page