(data stored in ACNUC7421 zone)

EMBL: AP010803.PE505

AP010803.PE505       Location/Qualifiers
FT   CDS             complement(510766..511752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="SJA_C1-05050"
FT                   /product="copper resistance protein CopB"
FT                   /note="uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95339"
FT                   /db_xref="GOA:D4YYA7"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA7"
FT                   /protein_id="BAI95339.1"
FT                   /translation="MIRIFPSRGIALGAALFLAPAITAPALAQDASPPSPAATPAQTAT
FT                   PAQHTPSAQGSQDHAGMDMPGMDMTDTKASGNGATMDMGSMQGGKAPPDARNSDDYADG
FT                   YRNSTLPGYEMADKLSIPKILVDELEFTSGNEGQGVGWTVLVTKGQDNDKLWLRSQGLK
FT                   NSRDQRLDPESSVEALWWHSKNPFWGTLLGVRQDLGKGATTWLAAGVEGLAPYWFDVQL
FT                   TGYVGTDGRLAARAKASYEVLFTNRLILTPQVETNIYSKRSSDRQLGSGFSNVELSGRL
FT                   RYEVSRKFAPYIGFVWERAFDGTADFRRLRREGPSEHRLVIGLRAWW"
     MIRIFPSRGI ALGAALFLAP AITAPALAQD ASPPSPAATP AQTATPAQHT PSAQGSQDHA        60
     GMDMPGMDMT DTKASGNGAT MDMGSMQGGK APPDARNSDD YADGYRNSTL PGYEMADKLS       120
     IPKILVDELE FTSGNEGQGV GWTVLVTKGQ DNDKLWLRSQ GLKNSRDQRL DPESSVEALW       180
     WHSKNPFWGT LLGVRQDLGK GATTWLAAGV EGLAPYWFDV QLTGYVGTDG RLAARAKASY       240
     EVLFTNRLIL TPQVETNIYS KRSSDRQLGS GFSNVELSGR LRYEVSRKFA PYIGFVWERA       300
     FDGTADFRRL RREGPSEHRL VIGLRAWW                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page