(data stored in ACNUC7421 zone)

EMBL: AP010803.PE506

AP010803.PE506       Location/Qualifiers
FT   CDS             complement(511749..513455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SJA_C1-05060"
FT                   /product="copper resistance protein CopA"
FT                   /note="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95340"
FT                   /db_xref="GOA:D4YYA8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA8"
FT                   /protein_id="BAI95340.1"
FT                   /translation="MSPLHIRPIARRRFVQGLAIGGAVAGFAPALLARSAPVSPAELSG
FT                   TEFDLEIAELPVNFTGKRRIATAVNGSVPAPVLRLREGDTVTLRVRNGLKEMSSIHWHG
FT                   IIVPAEMDGVPGISFAGIAPGETFTYRFEVRQSGTYWYHAHTLAEQTGLYGAIIVEPKQ
FT                   VPTARAPDRDYCIVLSDWSDEPPLQIFLNLKKQSSYYNFAQPTAGDFLKDVGTMGLGKA
FT                   LERRRMWNSSRMNPTDYSDVSAATYTYLMNGAPPAGNWTGIAAPGERVRLRFVGAGTAT
FT                   FFDVRIPGVELTVVSTDGQPVEPVTVEEFRIGPGETYDVEFTMPEGGARTIFAQAIDRS
FT                   GYARGTIAPAPGMAAAVPLLDARTWLEPVDMMGAMATMGAMGGDAHAGHGMTEMPARAR
FT                   HARTEYGANTDMRVDYPRTNLDDPGAGLRGRGWRVLTLADLRTPGGDPDPREPERDIEL
FT                   HLTGNMERFIWSLDGIKLNDSRPLHFKPNERLRVTFVNDTMMAHPMHLHGMWSDVEGPD
FT                   GAFQVRKHTVVVQPAQRVSFRVTADAMGRWAFHCHLLYHMAAGMFREVVVA"
     MSPLHIRPIA RRRFVQGLAI GGAVAGFAPA LLARSAPVSP AELSGTEFDL EIAELPVNFT        60
     GKRRIATAVN GSVPAPVLRL REGDTVTLRV RNGLKEMSSI HWHGIIVPAE MDGVPGISFA       120
     GIAPGETFTY RFEVRQSGTY WYHAHTLAEQ TGLYGAIIVE PKQVPTARAP DRDYCIVLSD       180
     WSDEPPLQIF LNLKKQSSYY NFAQPTAGDF LKDVGTMGLG KALERRRMWN SSRMNPTDYS       240
     DVSAATYTYL MNGAPPAGNW TGIAAPGERV RLRFVGAGTA TFFDVRIPGV ELTVVSTDGQ       300
     PVEPVTVEEF RIGPGETYDV EFTMPEGGAR TIFAQAIDRS GYARGTIAPA PGMAAAVPLL       360
     DARTWLEPVD MMGAMATMGA MGGDAHAGHG MTEMPARARH ARTEYGANTD MRVDYPRTNL       420
     DDPGAGLRGR GWRVLTLADL RTPGGDPDPR EPERDIELHL TGNMERFIWS LDGIKLNDSR       480
     PLHFKPNERL RVTFVNDTMM AHPMHLHGMW SDVEGPDGAF QVRKHTVVVQ PAQRVSFRVT       540
     ADAMGRWAFH CHLLYHMAAG MFREVVVA                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page