(data stored in ACNUC7421 zone)

EMBL: AP010803.PE510

AP010803.PE510       Location/Qualifiers
FT   CDS             516699..516878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95344"
FT                   /db_xref="GOA:D4YYB2"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB2"
FT                   /protein_id="BAI95344.1"
FT                   /translation="MILHHLVVHLLPSMIHPLLMGMGGGWLRLRRGVLGRGGCRLRQTR
FT                   ASEVQGRQAADRAD"
     MILHHLVVHL LPSMIHPLLM GMGGGWLRLR RGVLGRGGCR LRQTRASEVQ GRQAADRAD         59
//

If you have problems or comments...

PBIL Back to PBIL home page