(data stored in ACNUC7421 zone)

EMBL: AP010803.PE514

AP010803.PE514       Location/Qualifiers
FT   CDS             complement(518537..519259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05140"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95348"
FT                   /db_xref="GOA:D4YYB6"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB6"
FT                   /protein_id="BAI95348.1"
FT                   /translation="MSWQRLSYAVFIAALLVMVAAVAIRMRSDAPRDAGLVAQLVSPGP
FT                   LSSAHQSFAGQCTACHTPGKGVETRTCLTCHAGTDFGTKQSTQFHAKATQCTSCHVEHE
FT                   GERGIIRMDHAALLDMAKWRQPLAGMSTNTRSLTPETALNCASCHAFRDPHQGLFGTDC
FT                   ASCHKTDSWKIANYRHPSVNSTQCAECHKAPPSHFMEHFSMVSQRAAGSKARVDQCYAC
FT                   HATDSFNNIRKRGWYDHH"
     MSWQRLSYAV FIAALLVMVA AVAIRMRSDA PRDAGLVAQL VSPGPLSSAH QSFAGQCTAC        60
     HTPGKGVETR TCLTCHAGTD FGTKQSTQFH AKATQCTSCH VEHEGERGII RMDHAALLDM       120
     AKWRQPLAGM STNTRSLTPE TALNCASCHA FRDPHQGLFG TDCASCHKTD SWKIANYRHP       180
     SVNSTQCAEC HKAPPSHFME HFSMVSQRAA GSKARVDQCY ACHATDSFNN IRKRGWYDHH       240
//

If you have problems or comments...

PBIL Back to PBIL home page