(data stored in ACNUC7421 zone)

EMBL: AP010803.PE515

AP010803.PE515       Location/Qualifiers
FT   CDS             complement(519256..519984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95349"
FT                   /db_xref="GOA:D4YYB7"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB7"
FT                   /protein_id="BAI95349.1"
FT                   /translation="MRERSDIAVGLLVAFLLLFPFGYLVHVSPRFPGSLAGGIIGIAAL
FT                   VLMLLTLPYVAAKHIAWVDKALSRVVSKPTLLAIHIYAGVLAPILGLVHAAHKLESPVG
FT                   LLLTVLLLMTVITGFIGRYLLAQLGRALRGRRSELASLRAAFLEEPAAPTQADTAAPPL
FT                   SGWKRYLFVAGDASAGQRPQDKAGIAAALADTEFAIRAEEATNTLFARWRFLHILLGCL
FT                   IFALLALHVGAAIYYGLRWL"
     MRERSDIAVG LLVAFLLLFP FGYLVHVSPR FPGSLAGGII GIAALVLMLL TLPYVAAKHI        60
     AWVDKALSRV VSKPTLLAIH IYAGVLAPIL GLVHAAHKLE SPVGLLLTVL LLMTVITGFI       120
     GRYLLAQLGR ALRGRRSELA SLRAAFLEEP AAPTQADTAA PPLSGWKRYL FVAGDASAGQ       180
     RPQDKAGIAA ALADTEFAIR AEEATNTLFA RWRFLHILLG CLIFALLALH VGAAIYYGLR       240
     WL                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page