(data stored in ACNUC7421 zone)

EMBL: AP010803.PE52

AP010803.PE52        Location/Qualifiers
FT   CDS             52319..53782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00520"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="aminotransferase / transcriptional regulator
FT                   containing a DNA-binding HTH domain and an aminotransferase
FT                   domain (MocR family)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94886"
FT                   /db_xref="GOA:D4YX04"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX04"
FT                   /protein_id="BAI94886.1"
FT                   /translation="MSTSLLRPPSLLRLLGAWRAEDSAEPAYRQLAQALRMLVLDGRVG
FT                   LNVRLPGERELAAALGLSRTTIAAAFDRLRDEGFLESRQGSGSVTRLPPGRMDQALPEI
FT                   DTIGGGNILNWTHAALPAAPGVGRAYQAAVEALPAFLGELGYDPLGLPPLRRAIAAYYE
FT                   RRGCPTSPDQIIVTNGAQQGFSLLLHWLAGPGDRAVIDHPTYHNAIQALQRAHVVPVPV
FT                   GLPAQGWDIDAMEAAFRQTSPRFAYIIADFHNPTGRSMDPGTRRALVAAATRSHMPLII
FT                   DETMAAMGLDNMPPPPVAVHDPSGRQVITLGSASKIFWGGLRVGWIRADPQTVAALGRL
FT                   RTTMDMASPVVEQLAVAHLIDGDEGLGPRAAMLRGRRDHLLALIERHLPHWRAESPAGG
FT                   LSLWAELPRGEATALAAIAESHGVRVAPGPRFGVSGAFERFLRLPFTLSEEQLTAGVER
FT                   LAEADARLHARLPRARDSVAAALEADRLI"
     MSTSLLRPPS LLRLLGAWRA EDSAEPAYRQ LAQALRMLVL DGRVGLNVRL PGERELAAAL        60
     GLSRTTIAAA FDRLRDEGFL ESRQGSGSVT RLPPGRMDQA LPEIDTIGGG NILNWTHAAL       120
     PAAPGVGRAY QAAVEALPAF LGELGYDPLG LPPLRRAIAA YYERRGCPTS PDQIIVTNGA       180
     QQGFSLLLHW LAGPGDRAVI DHPTYHNAIQ ALQRAHVVPV PVGLPAQGWD IDAMEAAFRQ       240
     TSPRFAYIIA DFHNPTGRSM DPGTRRALVA AATRSHMPLI IDETMAAMGL DNMPPPPVAV       300
     HDPSGRQVIT LGSASKIFWG GLRVGWIRAD PQTVAALGRL RTTMDMASPV VEQLAVAHLI       360
     DGDEGLGPRA AMLRGRRDHL LALIERHLPH WRAESPAGGL SLWAELPRGE ATALAAIAES       420
     HGVRVAPGPR FGVSGAFERF LRLPFTLSEE QLTAGVERLA EADARLHARL PRARDSVAAA       480
     LEADRLI                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page