(data stored in SCRATCH zone)

EMBL: AP010803.PE521

AP010803.PE521       Location/Qualifiers
FT   CDS             523736..524098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95355"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC3"
FT                   /protein_id="BAI95355.1"
FT                   /translation="MKRLLALLLVIGALSGLFGAQMAAAHSVPQAAGAPLAKGMDADCM
FT                   AMMAKQQPAPSEKPCKGLTLDCIAAMGCVIPLVAADLAGGVAPARLYDAPSFWTTDTIL
FT                   TGKAVAPEPDPPTSLA"
     MKRLLALLLV IGALSGLFGA QMAAAHSVPQ AAGAPLAKGM DADCMAMMAK QQPAPSEKPC        60
     KGLTLDCIAA MGCVIPLVAA DLAGGVAPAR LYDAPSFWTT DTILTGKAVA PEPDPPTSLA       120
//

If you have problems or comments...

PBIL Back to PBIL home page