(data stored in ACNUC7421 zone)

EMBL: AP010803.PE527

AP010803.PE527       Location/Qualifiers
FT   CDS             531036..532331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05270"
FT                   /product="conserved hypothetical protein"
FT                   /note="type II site-specific deoxyribonuclease (EC
FT                   3.1.21.4)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95361"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC9"
FT                   /protein_id="BAI95361.1"
FT                   /translation="MTLLPATHHDLVSELVRRWRDDPGATYRSWFLWDERLKNFRSIRR
FT                   GLQQVVAEIESGRFGVAYRGSSLETVVHSIAEQRQIFKGADHAWLWKPKLRIPDIYESP
FT                   DNQRAFGRLLDNCSCCDTAEEIISHIRSIDALKIKGLGPAAANLLYFLHPTLVPPFNTA
FT                   IVKGYNAVTGAKVKLGSWDHFLAMRAGILDLNDRYRELLSNDLGAIGGLLFDIGSGRYP
FT                   APPLEDDATAADDWLGRLEHARAEASRLDKTAAAQGETDRTHAEIQAWLRDLGHALGYD
FT                   VWIAANDRGRLHAGCPLGQGCLERLPDAIATSPGADSIRLIDVLWLAKGGDGVAAAFEV
FT                   EHSTSIYSGIVRMLDLALSGSDLHAAAGLFLVAPNAREQDVRAQLRRPAFSRIADLDFA
FT                   YLPYGELERNRDAIARFGTGLKAIKAISSPLP"
     MTLLPATHHD LVSELVRRWR DDPGATYRSW FLWDERLKNF RSIRRGLQQV VAEIESGRFG        60
     VAYRGSSLET VVHSIAEQRQ IFKGADHAWL WKPKLRIPDI YESPDNQRAF GRLLDNCSCC       120
     DTAEEIISHI RSIDALKIKG LGPAAANLLY FLHPTLVPPF NTAIVKGYNA VTGAKVKLGS       180
     WDHFLAMRAG ILDLNDRYRE LLSNDLGAIG GLLFDIGSGR YPAPPLEDDA TAADDWLGRL       240
     EHARAEASRL DKTAAAQGET DRTHAEIQAW LRDLGHALGY DVWIAANDRG RLHAGCPLGQ       300
     GCLERLPDAI ATSPGADSIR LIDVLWLAKG GDGVAAAFEV EHSTSIYSGI VRMLDLALSG       360
     SDLHAAAGLF LVAPNAREQD VRAQLRRPAF SRIADLDFAY LPYGELERNR DAIARFGTGL       420
     KAIKAISSPL P                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page