(data stored in ACNUC7421 zone)

EMBL: AP010803.PE53

AP010803.PE53        Location/Qualifiers
FT   CDS             complement(53832..54089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94887"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX05"
FT                   /protein_id="BAI94887.1"
FT                   /translation="MQRPSGRRGRLRTGKRHAPANRRVVRRSRRPDLAARTWSGVARPA
FT                   DAGGKRTLPLFVTPDLIRGPAALDEAGAQTRKRDPGSSPG"
     MQRPSGRRGR LRTGKRHAPA NRRVVRRSRR PDLAARTWSG VARPADAGGK RTLPLFVTPD        60
     LIRGPAALDE AGAQTRKRDP GSSPG                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page