(data stored in ACNUC7421 zone)

EMBL: AP010803.PE533

AP010803.PE533       Location/Qualifiers
FT   CDS             complement(540003..540611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05330"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95367"
FT                   /db_xref="GOA:D4YYD5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD5"
FT                   /protein_id="BAI95367.1"
FT                   /translation="MIPGNDNNGGQERRTLWIVLLLNAAIAAGFFVSGFFADSSALIAN
FT                   GVDNLSDTAVYALSLVALTRGQTWKTRAAVASGVMLLIFAGGILIDVGRRYVQGSEPIG
FT                   PTMMVMSAIAGVVNYLCLRLLQRLKDPDVNLRAATTFSFNDFISNGGILIAGVLVLWLG
FT                   TNWPDLLVGFATAIIAIKGGVEILRDARAETKKSERRSS"
     MIPGNDNNGG QERRTLWIVL LLNAAIAAGF FVSGFFADSS ALIANGVDNL SDTAVYALSL        60
     VALTRGQTWK TRAAVASGVM LLIFAGGILI DVGRRYVQGS EPIGPTMMVM SAIAGVVNYL       120
     CLRLLQRLKD PDVNLRAATT FSFNDFISNG GILIAGVLVL WLGTNWPDLL VGFATAIIAI       180
     KGGVEILRDA RAETKKSERR SS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page