(data stored in ACNUC7421 zone)

EMBL: AP010803.PE536

AP010803.PE536       Location/Qualifiers
FT   CDS             complement(541759..542136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95370"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD8"
FT                   /protein_id="BAI95370.1"
FT                   /translation="MMMHCKRVLPAVILVVGLAACSERKPPAPPTEQQIHSSDSAVATG
FT                   EMGRHRYRCSDGEPLFVDYKDNGLQIDLRRSNGGPPMMLTAPAQGLQYVGETATATFKG
FT                   SQLTIVEGDGRTRICEQEGTR"
     MMMHCKRVLP AVILVVGLAA CSERKPPAPP TEQQIHSSDS AVATGEMGRH RYRCSDGEPL        60
     FVDYKDNGLQ IDLRRSNGGP PMMLTAPAQG LQYVGETATA TFKGSQLTIV EGDGRTRICE       120
     QEGTR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page