(data stored in SCRATCH zone)

EMBL: AP010803.PE537

AP010803.PE537       Location/Qualifiers
FT   CDS             complement(542133..542597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95371"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD9"
FT                   /protein_id="BAI95371.1"
FT                   /translation="MLHGGPLRIWSALTDPDHRRAWSPLVFLDDPSRLGDTECTFAIQG
FT                   ITRPIRTPARIDRFDKPHAFAWSCGIPYLFTLEERYELAGDDGGTRLTHSCTLRGALSL
FT                   PFAAMMLRRLRSLMVESDDRLATYLRWRVGQPARAINRQRVPFRCRRKAR"
     MLHGGPLRIW SALTDPDHRR AWSPLVFLDD PSRLGDTECT FAIQGITRPI RTPARIDRFD        60
     KPHAFAWSCG IPYLFTLEER YELAGDDGGT RLTHSCTLRG ALSLPFAAMM LRRLRSLMVE       120
     SDDRLATYLR WRVGQPARAI NRQRVPFRCR RKAR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page