(data stored in ACNUC7421 zone)

EMBL: AP010803.PE538

AP010803.PE538       Location/Qualifiers
FT   CDS             complement(542675..545920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /gene_synonym="czcA"
FT                   /locus_tag="SJA_C1-05380"
FT                   /product="copper/silver efflux system membrane protein
FT                   CusA/CzcA"
FT                   /note="copper efflux system membrane protein CusA /
FT                   putative silver efflux pump, CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95372"
FT                   /db_xref="GOA:D4YYE0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE0"
FT                   /protein_id="BAI95372.1"
FT                   /translation="MIARIVTWAVEKRWLVLLLTVIVAAIGAFSLYRLPIDAVPDITNN
FT                   QVQINVRAPALSPELVEKQVSFPIETALAGTPGLEYTRSLSRNGFAQITAVFSDATDIY
FT                   FARQQVGERLRGVQENLPDGVNPEMGPIATGLGEVYMYTVRLDHREDDKHKPGEPGQQP
FT                   DGSYITPEGERLTTEEDKATYLRTAQDWIVTPLLKTTPGLAGVDSIGGYAKQFLVVPDV
FT                   QKLASLGITLTDLGNALERNNTSVGGGFVNRNGEGLAVRSDALVRNASELARTVIATRN
FT                   GVPITVEQVATVKTGQAIRMGSASENGTEVVVGTAIMRIGENSRIVSTAVAEKLKTINA
FT                   SLPPDVVIQPVLNRTELVNSTIKTVAKNLSEGAVLVIVVLFLLLGNFRAALIAALVIPI
FT                   TMMLTGFGMLRAGVSANLMSLGALDFGLIVDGAVIIVENALRRLAEQQHHEGRLLSVKE
FT                   RLATVAAAAREMIRPSVYGQAIIILVYVPLLTLTGVEGKTFGPMALTVIIALAFAFILS
FT                   LTFVPAMIAIWLSKKVEEKDGRIITWLKKRYEPGLDRAMKRPTLTIGAGVGSLVVAALA
FT                   FTTLGSVFLPQLDEGDLLIQSLRIPATSVQQSQAMQVPIERMMSKQPEVQFVYSKTGTA
FT                   ELAADPMPPNATDMFVILKPRKDWPDPELPKEELVSRIEGNLAKIPGNAYEITQPIQMR
FT                   FNELIAGVRGDIAVKVFGDDFNQMNRTAEQIAAVLRRTQGAADVKVEQTTGLPMLDIRV
FT                   NRDAMARLGVTAQDVQDTVTATIGGRTSGQIFEGDRRFPVVIRLSEAQRADIGLLQQVQ
FT                   VPVAGGGYVPLSSVAEIKVVDGPNQISRENGKRRVVVQANVRGRDVGSVVADAQAAIGS
FT                   QLRLPAGTYLEWGGQFENLQSASERLKLVIPACFILILLLLYGALGSVRDAAIVFTGVP
FT                   FALVGGVLLLFLRGMDFSISAAVGFIALSGIAVLNGLVMVSSIQDLIRSGMSREEAAHV
FT                   GAMQRLRPVIMTALVASLGFVPMALGEGAGAEVQKPLATVVIGGLISATLLTLFVLPTL
FT                   YARFGQKVIEKPEHYNEEHEGDDHGQTFVNNLA"
     MIARIVTWAV EKRWLVLLLT VIVAAIGAFS LYRLPIDAVP DITNNQVQIN VRAPALSPEL        60
     VEKQVSFPIE TALAGTPGLE YTRSLSRNGF AQITAVFSDA TDIYFARQQV GERLRGVQEN       120
     LPDGVNPEMG PIATGLGEVY MYTVRLDHRE DDKHKPGEPG QQPDGSYITP EGERLTTEED       180
     KATYLRTAQD WIVTPLLKTT PGLAGVDSIG GYAKQFLVVP DVQKLASLGI TLTDLGNALE       240
     RNNTSVGGGF VNRNGEGLAV RSDALVRNAS ELARTVIATR NGVPITVEQV ATVKTGQAIR       300
     MGSASENGTE VVVGTAIMRI GENSRIVSTA VAEKLKTINA SLPPDVVIQP VLNRTELVNS       360
     TIKTVAKNLS EGAVLVIVVL FLLLGNFRAA LIAALVIPIT MMLTGFGMLR AGVSANLMSL       420
     GALDFGLIVD GAVIIVENAL RRLAEQQHHE GRLLSVKERL ATVAAAAREM IRPSVYGQAI       480
     IILVYVPLLT LTGVEGKTFG PMALTVIIAL AFAFILSLTF VPAMIAIWLS KKVEEKDGRI       540
     ITWLKKRYEP GLDRAMKRPT LTIGAGVGSL VVAALAFTTL GSVFLPQLDE GDLLIQSLRI       600
     PATSVQQSQA MQVPIERMMS KQPEVQFVYS KTGTAELAAD PMPPNATDMF VILKPRKDWP       660
     DPELPKEELV SRIEGNLAKI PGNAYEITQP IQMRFNELIA GVRGDIAVKV FGDDFNQMNR       720
     TAEQIAAVLR RTQGAADVKV EQTTGLPMLD IRVNRDAMAR LGVTAQDVQD TVTATIGGRT       780
     SGQIFEGDRR FPVVIRLSEA QRADIGLLQQ VQVPVAGGGY VPLSSVAEIK VVDGPNQISR       840
     ENGKRRVVVQ ANVRGRDVGS VVADAQAAIG SQLRLPAGTY LEWGGQFENL QSASERLKLV       900
     IPACFILILL LLYGALGSVR DAAIVFTGVP FALVGGVLLL FLRGMDFSIS AAVGFIALSG       960
     IAVLNGLVMV SSIQDLIRSG MSREEAAHVG AMQRLRPVIM TALVASLGFV PMALGEGAGA      1020
     EVQKPLATVV IGGLISATLL TLFVLPTLYA RFGQKVIEKP EHYNEEHEGD DHGQTFVNNL      1080
     A                                                                      1081
//

If you have problems or comments...

PBIL Back to PBIL home page