(data stored in ACNUC7421 zone)

EMBL: AP010803.PE540

AP010803.PE540       Location/Qualifiers
FT   CDS             complement(547102..548379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="SJA_C1-05400"
FT                   /product="cation resistance protein CzcC"
FT                   /note="heavy metal RND efflux outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95374"
FT                   /db_xref="GOA:D4YYE2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE2"
FT                   /protein_id="BAI95374.1"
FT                   /translation="MNRILAAMLAAASCATMAQAQVGPSAPVAQDAPVYTLDQAVSAAG
FT                   GSAPAAEAATAGIDAARAGRTVAGLRPNPVVQGQVENVIGSGPYRGVRSAETTVGFAIP
FT                   IELGGKRGARVAVANAQLSRAEIQAAIIAADVRLQVTQLYVEAVAADRRVMTARDQARI
FT                   ASDALRAASVRVQAGRASPLEQQRADVARINADANVERQLRLAEAARANLARRIGRPID
FT                   GLLDDTLLDRLPDVNVYGPLAPVNTTGTLALAAANADFSIAEAGVRLARANRVPDLNVG
FT                   PSIRRLEATNDMAAVFSVSIPIPVFNNGRAAIAQATAQRTQADAQRRVTALDIEQAITD
FT                   AQAQAANAATTARAASGPALAAAQEAARIARIGYREGKFGQLELLDAERTLAETRVAAI
FT                   DALANYQNARAQVERLTARAPNGGNQ"
     MNRILAAMLA AASCATMAQA QVGPSAPVAQ DAPVYTLDQA VSAAGGSAPA AEAATAGIDA        60
     ARAGRTVAGL RPNPVVQGQV ENVIGSGPYR GVRSAETTVG FAIPIELGGK RGARVAVANA       120
     QLSRAEIQAA IIAADVRLQV TQLYVEAVAA DRRVMTARDQ ARIASDALRA ASVRVQAGRA       180
     SPLEQQRADV ARINADANVE RQLRLAEAAR ANLARRIGRP IDGLLDDTLL DRLPDVNVYG       240
     PLAPVNTTGT LALAAANADF SIAEAGVRLA RANRVPDLNV GPSIRRLEAT NDMAAVFSVS       300
     IPIPVFNNGR AAIAQATAQR TQADAQRRVT ALDIEQAITD AQAQAANAAT TARAASGPAL       360
     AAAQEAARIA RIGYREGKFG QLELLDAERT LAETRVAAID ALANYQNARA QVERLTARAP       420
     NGGNQ                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page