(data stored in ACNUC7421 zone)

EMBL: AP010803.PE541

AP010803.PE541       Location/Qualifiers
FT   CDS             complement(548440..548769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95375"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE3"
FT                   /protein_id="BAI95375.1"
FT                   /translation="MRAFLPFLTCLMLVLTSFSGMAHAADLAGGSIAGVEFTVHTAGDI
FT                   DQVPSDSDKNVPHHHNYCHGHDVGAPARTTMEYTPVLTVPKPTISASASLDGRTGMVHL
FT                   RPPQA"
     MRAFLPFLTC LMLVLTSFSG MAHAADLAGG SIAGVEFTVH TAGDIDQVPS DSDKNVPHHH        60
     NYCHGHDVGA PARTTMEYTP VLTVPKPTIS ASASLDGRTG MVHLRPPQA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page