(data stored in ACNUC7421 zone)

EMBL: AP010803.PE543

AP010803.PE543       Location/Qualifiers
FT   CDS             complement(550777..551403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05430"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95377"
FT                   /db_xref="GOA:D4YYE5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE5"
FT                   /protein_id="BAI95377.1"
FT                   /translation="MNASTESCGCHGEPARAQTDPAYRRALLTVVVLNLGFGVAELFGG
FT                   FIADSQALKADSLDFLGDGSISLIGLLALAWSARARAKVALTQGLFLGALGVGVIGFAI
FT                   WRALNATAPDAELMGTIGVVALAINVVSALVLARFREGDANVRAIWLFSRNDALANVAV
FT                   IAAAGLVAWTGSAWPDLAVAGLIALLFLHSAYEIVTGARRELGER"
     MNASTESCGC HGEPARAQTD PAYRRALLTV VVLNLGFGVA ELFGGFIADS QALKADSLDF        60
     LGDGSISLIG LLALAWSARA RAKVALTQGL FLGALGVGVI GFAIWRALNA TAPDAELMGT       120
     IGVVALAINV VSALVLARFR EGDANVRAIW LFSRNDALAN VAVIAAAGLV AWTGSAWPDL       180
     AVAGLIALLF LHSAYEIVTG ARRELGER                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page