(data stored in ACNUC7421 zone)

EMBL: AP010803.PE545

AP010803.PE545       Location/Qualifiers
FT   CDS             complement(551892..553094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95379"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE7"
FT                   /protein_id="BAI95379.1"
FT                   /translation="MSRRSLVARLVACGTGLVLGSPTLARQTSRSAGSWNFGAAHLEWE
FT                   PLEVGTGDTLLVSAQVRGVPVRAVLDSGSGASIMSTALAAKLGLNDGERRMISGLSAKA
FT                   PVLLVRDIDVQLARETRRLPFAVVGDLSSVSAAFGRPIDILLGADMFTGSCIALDFAKR
FT                   RMAVVKSGTFLAGPDWRAVALGRGAKQELFIRASVSGLPPVPLMIDLGSSAALMLSSAY
FT                   ARDQGLLNGKLVSTAAIGGVDGVRINDAFTIQNINIEGLGVSNVPTLGMRAWLSTSTVG
FT                   NVGLPLIAQFDVVFDVTAGFVWLRPLGPRRRLPMLKDRSGLGLAASPTALTVVHVAANS
FT                   PAEKAGWAVGDRIVAVNGHSIDANYTRGELWQVRSRPAGTLVKLTMASGDVRELRLADY
FT                   Y"
     MSRRSLVARL VACGTGLVLG SPTLARQTSR SAGSWNFGAA HLEWEPLEVG TGDTLLVSAQ        60
     VRGVPVRAVL DSGSGASIMS TALAAKLGLN DGERRMISGL SAKAPVLLVR DIDVQLARET       120
     RRLPFAVVGD LSSVSAAFGR PIDILLGADM FTGSCIALDF AKRRMAVVKS GTFLAGPDWR       180
     AVALGRGAKQ ELFIRASVSG LPPVPLMIDL GSSAALMLSS AYARDQGLLN GKLVSTAAIG       240
     GVDGVRINDA FTIQNINIEG LGVSNVPTLG MRAWLSTSTV GNVGLPLIAQ FDVVFDVTAG       300
     FVWLRPLGPR RRLPMLKDRS GLGLAASPTA LTVVHVAANS PAEKAGWAVG DRIVAVNGHS       360
     IDANYTRGEL WQVRSRPAGT LVKLTMASGD VRELRLADYY                             400
//

If you have problems or comments...

PBIL Back to PBIL home page