(data stored in ACNUC7421 zone)

EMBL: AP010803.PE546

AP010803.PE546       Location/Qualifiers
FT   CDS             complement(553384..553956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05460"
FT                   /product="invertase/recombinase like protein"
FT                   /note="site-specific recombinase, DNA invertase Pin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95380"
FT                   /db_xref="GOA:D4YYE8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE8"
FT                   /protein_id="BAI95380.1"
FT                   /translation="MKIGYARVSTAEQNLDLQRDALKAAGCEKVITDKASGATAARPGL
FT                   EKVKELLRAGDTLVVWRLDRLGRSLRDLIGWMTYLDEEKVGLLSLHEAIDTTTTSGKLT
FT                   FHLFGALAEFERNLIRERTQAGLTAARARGKKGGRPAALGKDKRDLPVRLYHENTMPIA
FT                   KICSMLGISKPKLYAYVRSAETKPVAA"
     MKIGYARVST AEQNLDLQRD ALKAAGCEKV ITDKASGATA ARPGLEKVKE LLRAGDTLVV        60
     WRLDRLGRSL RDLIGWMTYL DEEKVGLLSL HEAIDTTTTS GKLTFHLFGA LAEFERNLIR       120
     ERTQAGLTAA RARGKKGGRP AALGKDKRDL PVRLYHENTM PIAKICSMLG ISKPKLYAYV       180
     RSAETKPVAA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page