(data stored in ACNUC7421 zone)

EMBL: AP010803.PE55

AP010803.PE55        Location/Qualifiers
FT   CDS             complement(54832..55257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00550"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94889"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX07"
FT                   /protein_id="BAI94889.1"
FT                   /translation="MDFWEKPLDKLDRAEWEALCDGCGKCCLHKAEDEDTGRIYPTNVA
FT                   CRLLDRHSGQCTNYKERRRFVPDCVRLTPAKVKTIGWLPRTCAYRLRGEGKPLPQWHYL
FT                   VCGDREAVHRAQESVRGWTVAEADAGDWENHLVDREL"
     MDFWEKPLDK LDRAEWEALC DGCGKCCLHK AEDEDTGRIY PTNVACRLLD RHSGQCTNYK        60
     ERRRFVPDCV RLTPAKVKTI GWLPRTCAYR LRGEGKPLPQ WHYLVCGDRE AVHRAQESVR       120
     GWTVAEADAG DWENHLVDRE L                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page