(data stored in ACNUC7421 zone)

EMBL: AP010803.PE554

AP010803.PE554       Location/Qualifiers
FT   CDS             complement(562738..563379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05540"
FT                   /product="hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95388"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF6"
FT                   /protein_id="BAI95388.1"
FT                   /translation="MTPQAFHDHWRYPHGSLGQGIRIIKRYVQSHQVDVDFLDADQNRY
FT                   EGIAEVWFDSEADAAAFVTDPDYVAYALKDEPNFVDMDNFFAVFAREEVLKSRAEALRG
FT                   DEAAYNWSIDRRPNFAKLTQVVFEEGGTAWAGDDDFALGERLGAFRHTRCHPIEKLVLP
FT                   GPSVIGVRELYWPTRTLAEQGIAAAGDAFHALFSRAPKAQTIFSISERYV"
     MTPQAFHDHW RYPHGSLGQG IRIIKRYVQS HQVDVDFLDA DQNRYEGIAE VWFDSEADAA        60
     AFVTDPDYVA YALKDEPNFV DMDNFFAVFA REEVLKSRAE ALRGDEAAYN WSIDRRPNFA       120
     KLTQVVFEEG GTAWAGDDDF ALGERLGAFR HTRCHPIEKL VLPGPSVIGV RELYWPTRTL       180
     AEQGIAAAGD AFHALFSRAP KAQTIFSISE RYV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page