(data stored in ACNUC7421 zone)

EMBL: AP010803.PE555

AP010803.PE555       Location/Qualifiers
FT   CDS             complement(563452..564213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05550"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95389"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF7"
FT                   /protein_id="BAI95389.1"
FT                   /translation="MSGLEQRSYIVTGAGGSIGRAAALILARRGANVVVADIVEAAAEE
FT                   TVRLIRAEGGNAVYSHCDVSIEDNAWSTVELAITEFGRLDGAFNNAGLPPVNVPLHQLT
FT                   SADFQRSLDINVLGVFHCMKHQIAAMLKAGSGGSIVNTASVGGTVAIPAHGEYIAAKHA
FT                   VIGLTRIAAVDYGQQGIRVNAVLPGAIRTPMLMSVIENEPSHAEFLKTAHPIGRYGEPA
FT                   EIGETAAWLLSDASSFVTGAAIAADGGYTAI"
     MSGLEQRSYI VTGAGGSIGR AAALILARRG ANVVVADIVE AAAEETVRLI RAEGGNAVYS        60
     HCDVSIEDNA WSTVELAITE FGRLDGAFNN AGLPPVNVPL HQLTSADFQR SLDINVLGVF       120
     HCMKHQIAAM LKAGSGGSIV NTASVGGTVA IPAHGEYIAA KHAVIGLTRI AAVDYGQQGI       180
     RVNAVLPGAI RTPMLMSVIE NEPSHAEFLK TAHPIGRYGE PAEIGETAAW LLSDASSFVT       240
     GAAIAADGGY TAI                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page