(data stored in ACNUC7421 zone)

EMBL: AP010803.PE556

AP010803.PE556       Location/Qualifiers
FT   CDS             complement(564260..565525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05560"
FT                   /product="putative dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /note="phenylpropionate dioxygenase or related
FT                   ring-hydroxylating dioxygenase, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95390"
FT                   /db_xref="GOA:D4YYF8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF8"
FT                   /protein_id="BAI95390.1"
FT                   /translation="MNEMTELASICTSDLTQTAGLGTGPVSCEPYRSPAYFERERENLF
FT                   KRAWLTVGRVEQLPEKGSFFTKTIEIWNAPIVVTRGSDDRIQAFYNVCAHRGNQVVLTE
FT                   RGRASRFSCNYHNWVYRNDGSLMGVPDEANFFDLDKKKCGLVPIATDVWEGWIFLNHQK
FT                   QPEVSLQEFLGDFGTRFAGVSWENTDTSLYFEAHLDANWKVLADAFSETYHIPSIHPAT
FT                   IGKTFASAVNPHSRPLDARFWGPHRQFSTFGNPDYAPPEDAMVEKMAYANRDTGNVLGA
FT                   AETAGMTEYLDHPAINPKQSKHWALDIAVAFPTLHINLSPGGFWSHRFWPISVNRTRWE
FT                   AEFHVPKPLTGREKLQQELYITRIAGILLEDVTNTERTQRGIEAGAYDTMQLQDGEVQI
FT                   RHNLHHVDRWVNARTVREALGI"
     MNEMTELASI CTSDLTQTAG LGTGPVSCEP YRSPAYFERE RENLFKRAWL TVGRVEQLPE        60
     KGSFFTKTIE IWNAPIVVTR GSDDRIQAFY NVCAHRGNQV VLTERGRASR FSCNYHNWVY       120
     RNDGSLMGVP DEANFFDLDK KKCGLVPIAT DVWEGWIFLN HQKQPEVSLQ EFLGDFGTRF       180
     AGVSWENTDT SLYFEAHLDA NWKVLADAFS ETYHIPSIHP ATIGKTFASA VNPHSRPLDA       240
     RFWGPHRQFS TFGNPDYAPP EDAMVEKMAY ANRDTGNVLG AAETAGMTEY LDHPAINPKQ       300
     SKHWALDIAV AFPTLHINLS PGGFWSHRFW PISVNRTRWE AEFHVPKPLT GREKLQQELY       360
     ITRIAGILLE DVTNTERTQR GIEAGAYDTM QLQDGEVQIR HNLHHVDRWV NARTVREALG       420
     I                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page