(data stored in ACNUC7421 zone)

EMBL: AP010803.PE558

AP010803.PE558       Location/Qualifiers
FT   CDS             complement(565901..566587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05580"
FT                   /product="hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95392"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG0"
FT                   /protein_id="BAI95392.1"
FT                   /translation="MHSIKILATIPRRKDISEQQFHDHWRHPHGTLSKKIACLRGYVQS
FT                   HRIVSPLLPDTQLAYDGITELWYDSLDDALNMGKDPAHRKYNIPDEPLFVDMDGLKFTF
FT                   FEEDIIRSRPAVDDPDDAAVQWSPTEWSVSVKILQLVKADGNPAWAGDQDKALGDRIGA
FT                   FRHVRSFAIDAVHKGTSPFIGARELWWPTLSDFERGVAGDRAAFDALLAQAGQHYTMLA
FT                   SAERVI"
     MHSIKILATI PRRKDISEQQ FHDHWRHPHG TLSKKIACLR GYVQSHRIVS PLLPDTQLAY        60
     DGITELWYDS LDDALNMGKD PAHRKYNIPD EPLFVDMDGL KFTFFEEDII RSRPAVDDPD       120
     DAAVQWSPTE WSVSVKILQL VKADGNPAWA GDQDKALGDR IGAFRHVRSF AIDAVHKGTS       180
     PFIGARELWW PTLSDFERGV AGDRAAFDAL LAQAGQHYTM LASAERVI                    228
//

If you have problems or comments...

PBIL Back to PBIL home page