(data stored in ACNUC7421 zone)

EMBL: AP010803.PE560

AP010803.PE560       Location/Qualifiers
FT   CDS             complement(567401..568177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05600"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95394"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG2"
FT                   /protein_id="BAI95394.1"
FT                   /translation="MQQSPKGYKAGSFPGVSAGTFAQYAAVTQESLVDYEAGFKTTLFD
FT                   RKVTLNGGVFYYDYKNKQLRAKIVDPFFNALDGLVNVPKSRVKGAELELSARVVEGLTV
FT                   SAAATYIDAKVRHYQGIVGSVANEVGLFDPIRGDFSGARLPFSPKWQSSLSADYSLPLG
FT                   GVNLTMGTTISSQSKSLGVLAITNADKDLYEVNGRTLVSARLGVEAPDGRWAVFGWGRN
FT                   IFNKYYLTNTIQTYDTVVRYAGRPAEYGMTVRFKFQ"
     MQQSPKGYKA GSFPGVSAGT FAQYAAVTQE SLVDYEAGFK TTLFDRKVTL NGGVFYYDYK        60
     NKQLRAKIVD PFFNALDGLV NVPKSRVKGA ELELSARVVE GLTVSAAATY IDAKVRHYQG       120
     IVGSVANEVG LFDPIRGDFS GARLPFSPKW QSSLSADYSL PLGGVNLTMG TTISSQSKSL       180
     GVLAITNADK DLYEVNGRTL VSARLGVEAP DGRWAVFGWG RNIFNKYYLT NTIQTYDTVV       240
     RYAGRPAEYG MTVRFKFQ                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page