(data stored in ACNUC7421 zone)

EMBL: AP010803.PE564

AP010803.PE564       Location/Qualifiers
FT   CDS             574788..575819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05640"
FT                   /product="Fic-family protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95398"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG6"
FT                   /protein_id="BAI95398.1"
FT                   /translation="MLGRAEALAASLPDPYIISRTLSRREAVDSSAIEGTNSTLDELLT
FT                   IEEEDDDARDAARQVRDYALTLDRLLPRAAAEGIDIFTVQMIQELHHEAMQHDPEYPDS
FT                   AGALRNIVVWIGGTGHISTSTYNPAPPGQVGACLEDTAAYMRCEGMQAMTQSLITRMAI
FT                   AHAHFEAVHPFRDGNGRVGRLLLPMMMAAEGQVPLYLAPYIAANRDGYYSGLKIAQQRL
FT                   EWGPLVGYLSDAITGTVEELFATRDGLNALKEQWRGRRKFRSNSAALRALDLLSDYPVV
FT                   TMKRLAQKLGVSRPQALSAINQLMEAGILSERTGYSRNRIFAAQEVLAIVNRPFGSNPS
FT                   ERS"
     MLGRAEALAA SLPDPYIISR TLSRREAVDS SAIEGTNSTL DELLTIEEED DDARDAARQV        60
     RDYALTLDRL LPRAAAEGID IFTVQMIQEL HHEAMQHDPE YPDSAGALRN IVVWIGGTGH       120
     ISTSTYNPAP PGQVGACLED TAAYMRCEGM QAMTQSLITR MAIAHAHFEA VHPFRDGNGR       180
     VGRLLLPMMM AAEGQVPLYL APYIAANRDG YYSGLKIAQQ RLEWGPLVGY LSDAITGTVE       240
     ELFATRDGLN ALKEQWRGRR KFRSNSAALR ALDLLSDYPV VTMKRLAQKL GVSRPQALSA       300
     INQLMEAGIL SERTGYSRNR IFAAQEVLAI VNRPFGSNPS ERS                         343
//

If you have problems or comments...

PBIL Back to PBIL home page