(data stored in ACNUC7421 zone)

EMBL: AP010803.PE565

AP010803.PE565       Location/Qualifiers
FT   CDS             complement(576050..576367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95399"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG7"
FT                   /protein_id="BAI95399.1"
FT                   /translation="MTPMDGPRGASAGEARHRERGRKGPSPARRRGEFGSHFSDVYRER
FT                   RIQLPESSSRKRNRKESQEYIGRCFQQHCDAASTSFGLLPPPANRSMLRRLIHFRHRCT
FT                   A"
     MTPMDGPRGA SAGEARHRER GRKGPSPARR RGEFGSHFSD VYRERRIQLP ESSSRKRNRK        60
     ESQEYIGRCF QQHCDAASTS FGLLPPPANR SMLRRLIHFR HRCTA                       105
//

If you have problems or comments...

PBIL Back to PBIL home page