(data stored in ACNUC7421 zone)

EMBL: AP010803.PE567

AP010803.PE567       Location/Qualifiers
FT   CDS             complement(577626..580052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05670"
FT                   /product="putative dehydrogenase/reductase"
FT                   /note="uncharacterized NAD(FAD)-dependent dehydrogenase /
FT                   pyridine nucleotide-disulphide oxidoreductase family
FT                   protein / putative ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95401"
FT                   /db_xref="GOA:D4YYG9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG9"
FT                   /protein_id="BAI95401.1"
FT                   /translation="MASERFDFLLLGGGLASATAAETLRREGAIGTIGILSAEEFPPYH
FT                   RPRLSKQYLIGTSTDVDILVHPVDYYRQQNISLVLGAEVTAVDPASRTVRTDDGDSFEY
FT                   GKLLIATGAAPRRLDVSGADKEGVFYLRRKVDCDVVRKAAQPGRKVVVLGASFLGMEIA
FT                   LSLIELGLEVTMLDIATRVLPHLEAPAISTFFQGYAEGKGATILLDDTAVEVIGDGHVA
FT                   GVRTQKGREIPCDMVIVSVGVMPATSFLDGSGILLEHGFVAVDDRLRTNTEDVFAAGDV
FT                   TSFYDPVFRRRRHIEHWDNAVRQGRLAARNMIGRRLRYDEVSYFYCEMGELGFDMLGIP
FT                   ENAEDWISRGDLKDGSYALFYLRDDVPQAAFSMGRPSSEIRVAEGLIRYRVNLERYRDQ
FT                   LGDPAYLLETIPAQKVLVLQGGGALGAFECGVVHALEEEHIFPDIVAGVSIGALNGAII
FT                   AGNPRHSTEALQSFWNDLTVVAPPLPFAEMRRAAVGAQILAFGVPKFFKPRWMPPFDFL
FT                   APWTGYYDTSPMRRLIAQYVDFSSLKSSPVRLLVGAVNVTTAQLEVFDSYIDDLTPDHV
FT                   LASGSLPPGFSWTVVDGTAYWDGGIVSNSPLDLVLDRCGPDGKRIYIVDLFAGDAPLPT
FT                   NMIEVLARRDEVVYSERVRSDLRIREMTDAYRSMINIILSGIDQVERAKIMRHPRFIQL
FT                   MGDGFTNEITRFQRPRRPGEASSRDYDFSDESIRRLQAEGYDLVKQTLVKTSKAGVSAT
FT                   PKASSALEEIKHAEAAAGTAAGRSLSGADAVLQTIAQAAPVLGTPRKRKSKKESP"
     MASERFDFLL LGGGLASATA AETLRREGAI GTIGILSAEE FPPYHRPRLS KQYLIGTSTD        60
     VDILVHPVDY YRQQNISLVL GAEVTAVDPA SRTVRTDDGD SFEYGKLLIA TGAAPRRLDV       120
     SGADKEGVFY LRRKVDCDVV RKAAQPGRKV VVLGASFLGM EIALSLIELG LEVTMLDIAT       180
     RVLPHLEAPA ISTFFQGYAE GKGATILLDD TAVEVIGDGH VAGVRTQKGR EIPCDMVIVS       240
     VGVMPATSFL DGSGILLEHG FVAVDDRLRT NTEDVFAAGD VTSFYDPVFR RRRHIEHWDN       300
     AVRQGRLAAR NMIGRRLRYD EVSYFYCEMG ELGFDMLGIP ENAEDWISRG DLKDGSYALF       360
     YLRDDVPQAA FSMGRPSSEI RVAEGLIRYR VNLERYRDQL GDPAYLLETI PAQKVLVLQG       420
     GGALGAFECG VVHALEEEHI FPDIVAGVSI GALNGAIIAG NPRHSTEALQ SFWNDLTVVA       480
     PPLPFAEMRR AAVGAQILAF GVPKFFKPRW MPPFDFLAPW TGYYDTSPMR RLIAQYVDFS       540
     SLKSSPVRLL VGAVNVTTAQ LEVFDSYIDD LTPDHVLASG SLPPGFSWTV VDGTAYWDGG       600
     IVSNSPLDLV LDRCGPDGKR IYIVDLFAGD APLPTNMIEV LARRDEVVYS ERVRSDLRIR       660
     EMTDAYRSMI NIILSGIDQV ERAKIMRHPR FIQLMGDGFT NEITRFQRPR RPGEASSRDY       720
     DFSDESIRRL QAEGYDLVKQ TLVKTSKAGV SATPKASSAL EEIKHAEAAA GTAAGRSLSG       780
     ADAVLQTIAQ AAPVLGTPRK RKSKKESP                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page