(data stored in SCRATCH zone)

EMBL: AP010803.PE569

AP010803.PE569       Location/Qualifiers
FT   CDS             581062..581436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05690"
FT                   /product="phasin-family protein"
FT                   /note="phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95403"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH1"
FT                   /protein_id="BAI95403.1"
FT                   /translation="MTANDSPPDSDVGARTLAAANLDRMHQVLDVAMKSGQSSLSAARA
FT                   NGVRASKLAVETTTKTIAYSQATAAASTEHLTRLMQVRDFKEAADLQAEFVRSRLAAFQ
FT                   DYLRDISKTAETALLDPTSE"
     MTANDSPPDS DVGARTLAAA NLDRMHQVLD VAMKSGQSSL SAARANGVRA SKLAVETTTK        60
     TIAYSQATAA ASTEHLTRLM QVRDFKEAAD LQAEFVRSRL AAFQDYLRDI SKTAETALLD       120
     PTSE                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page