(data stored in ACNUC7421 zone)

EMBL: AP010803.PE57

AP010803.PE57        Location/Qualifiers
FT   CDS             55989..56600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00570"
FT                   /product="ankyrin repeat protein"
FT                   /note="FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94891"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX09"
FT                   /protein_id="BAI94891.1"
FT                   /translation="MGVGRAAALTLALLSPVAAPMVARAQFSDNYNFLKAVKDADGQKV
FT                   TDLIQKPGSTVINSRDVTTGDTALHLVIARRDNTWLTFLLAKGANPNLTDNNGNTPLMD
FT                   AVQARFEEGARSLLTYNAQVDKANGSGETPLIRAVQLRDVGLVRLLVAQGANPDRRDTI
FT                   AGMSARDYAQRDNRTPGLVEALSAAKTTTAPKGPVQGPVF"
     MGVGRAAALT LALLSPVAAP MVARAQFSDN YNFLKAVKDA DGQKVTDLIQ KPGSTVINSR        60
     DVTTGDTALH LVIARRDNTW LTFLLAKGAN PNLTDNNGNT PLMDAVQARF EEGARSLLTY       120
     NAQVDKANGS GETPLIRAVQ LRDVGLVRLL VAQGANPDRR DTIAGMSARD YAQRDNRTPG       180
     LVEALSAAKT TTAPKGPVQG PVF                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page