(data stored in ACNUC7421 zone)

EMBL: AP010803.PE570

AP010803.PE570       Location/Qualifiers
FT   CDS             581549..581941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95404"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH2"
FT                   /protein_id="BAI95404.1"
FT                   /translation="MHVCVGHTQRPIAAKRAFLVKAMRCWCLARRETRLVQPHLARLLA
FT                   PCACEVLAPVLDALFSSFEACLGRPVVAGHHHPLARDELDLLALLTRPASADSRFPQSP
FT                   LKTVLRVALCSTRIMVALTLQEIGQR"
     MHVCVGHTQR PIAAKRAFLV KAMRCWCLAR RETRLVQPHL ARLLAPCACE VLAPVLDALF        60
     SSFEACLGRP VVAGHHHPLA RDELDLLALL TRPASADSRF PQSPLKTVLR VALCSTRIMV       120
     ALTLQEIGQR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page