(data stored in SCRATCH zone)

EMBL: AP010803.PE576

AP010803.PE576       Location/Qualifiers
FT   CDS             complement(586672..587202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95410"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH8"
FT                   /protein_id="BAI95410.1"
FT                   /translation="MNEMRWMTGSLIALALLTGGVASAQAFQPRNGAPQEQDDLSDEAQ
FT                   PPADDPGPPQADDDFSDVVAADQERGGAAAPSERYGSQDDPAGAAPADRESEDAITYCA
FT                   LAARDEAERDGGYAEVRQVQEPRETRNGYDVEGDVEIRSGWRTQDGRSRHFTCSVQNGR
FT                   IADLYFRRDRAAR"
     MNEMRWMTGS LIALALLTGG VASAQAFQPR NGAPQEQDDL SDEAQPPADD PGPPQADDDF        60
     SDVVAADQER GGAAAPSERY GSQDDPAGAA PADRESEDAI TYCALAARDE AERDGGYAEV       120
     RQVQEPRETR NGYDVEGDVE IRSGWRTQDG RSRHFTCSVQ NGRIADLYFR RDRAAR           176
//

If you have problems or comments...

PBIL Back to PBIL home page