(data stored in ACNUC7421 zone)

EMBL: AP010803.PE585

AP010803.PE585       Location/Qualifiers
FT   CDS             complement(596357..596626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95419"
FT                   /db_xref="GOA:D4YYI7"
FT                   /db_xref="InterPro:IPR021497"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI7"
FT                   /protein_id="BAI95419.1"
FT                   /translation="MTSSRRRIAGDRWTLRARPAFLYVMYGLLLWSVPLGLIGGVRPDV
FT                   AAEIIRAMRAYFNALPEPLYALFGTGYLGYTAARAWGKAKGVER"
     MTSSRRRIAG DRWTLRARPA FLYVMYGLLL WSVPLGLIGG VRPDVAAEII RAMRAYFNAL        60
     PEPLYALFGT GYLGYTAARA WGKAKGVER                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page