(data stored in ACNUC7421 zone)

EMBL: AP010803.PE586

AP010803.PE586       Location/Qualifiers
FT   CDS             complement(596637..597209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05860"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative secretion activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95420"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI8"
FT                   /protein_id="BAI95420.1"
FT                   /translation="MIRLSATGGRFMDIAALIDEVIAREGGYSNHPADRGGPTHFGITQ
FT                   AVARANGYGGDMRAMPRTVAEAIYRRLYWERPGFAFVAELAPAVAEELFDTAVNMGPGT
FT                   AGGFLQRALNALNRNGRDYPDLKVDQAVGAKTIAALGAFLAVRGRAGEKVLLKALEALQ
FT                   GERYLALAESRPANEAFLYGWLANRIG"
     MIRLSATGGR FMDIAALIDE VIAREGGYSN HPADRGGPTH FGITQAVARA NGYGGDMRAM        60
     PRTVAEAIYR RLYWERPGFA FVAELAPAVA EELFDTAVNM GPGTAGGFLQ RALNALNRNG       120
     RDYPDLKVDQ AVGAKTIAAL GAFLAVRGRA GEKVLLKALE ALQGERYLAL AESRPANEAF       180
     LYGWLANRIG                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page