(data stored in ACNUC7421 zone)

EMBL: AP010803.PE590

AP010803.PE590       Location/Qualifiers
FT   CDS             600658..600927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05900"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95424"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ2"
FT                   /protein_id="BAI95424.1"
FT                   /translation="MRALAWRDAPAVDALTVAHLGDLFDLEIQPEFLLVGTGAGLRQPP
FT                   RAFVRELEGRGIGVEAMDSRAAARAWGVLRAEDRWIVAALMPLV"
     MRALAWRDAP AVDALTVAHL GDLFDLEIQP EFLLVGTGAG LRQPPRAFVR ELEGRGIGVE        60
     AMDSRAAARA WGVLRAEDRW IVAALMPLV                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page