(data stored in ACNUC7421 zone)

EMBL: AP010803.PE595

AP010803.PE595       Location/Qualifiers
FT   CDS             complement(605229..606152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05950"
FT                   /product="D-galactose 1-dehydrogenase"
FT                   /EC_number="1.1.1.48"
FT                   /note="putative dehydrogenase or related protein /
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95429"
FT                   /db_xref="GOA:D4YYJ7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ7"
FT                   /protein_id="BAI95429.1"
FT                   /translation="MTIRAGLVGLGKIARDQHLPAIARTDGIELVAVASRNAQEEGLNN
FT                   YPDLDAMLAGEADMDAVILCQPPQVRYQAARQAILAGKHVFLEKPPGATVSEVEALIAL
FT                   AGAQGVTLYASWHSRHAAAVAQAKAWMASRAIRRIDIQWREDVRHWHPGQPWIWEAGGF
FT                   GVFDPGINALSILTEIVPEPVTMLSARLEVPENKDAPIGAALSMATASGAAVEALFDWR
FT                   QTGPQTWDIAVETANGSLLLSEGGNTLRLDGEVQIKAPDEEYPAMYRRFVGLVADRAID
FT                   ADIAPLRLVADAFLCGRHCPTTAFDD"
     MTIRAGLVGL GKIARDQHLP AIARTDGIEL VAVASRNAQE EGLNNYPDLD AMLAGEADMD        60
     AVILCQPPQV RYQAARQAIL AGKHVFLEKP PGATVSEVEA LIALAGAQGV TLYASWHSRH       120
     AAAVAQAKAW MASRAIRRID IQWREDVRHW HPGQPWIWEA GGFGVFDPGI NALSILTEIV       180
     PEPVTMLSAR LEVPENKDAP IGAALSMATA SGAAVEALFD WRQTGPQTWD IAVETANGSL       240
     LLSEGGNTLR LDGEVQIKAP DEEYPAMYRR FVGLVADRAI DADIAPLRLV ADAFLCGRHC       300
     PTTAFDD                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page