(data stored in ACNUC7421 zone)

EMBL: AP010803.PE596

AP010803.PE596       Location/Qualifiers
FT   CDS             complement(606149..607126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05960"
FT                   /product="putative sugar transporter"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95430"
FT                   /db_xref="GOA:D4YYJ8"
FT                   /db_xref="InterPro:IPR009645"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ8"
FT                   /protein_id="BAI95430.1"
FT                   /translation="MIRSLVQFEEGGRRGVAALDGTGAARRVEGADSTRALALEAIAAG
FT                   QGLAAMAEPRLGGTVDLSAVRLLCPIDHEDAAHLLVAGTGLTHLGSAEGRDKMHKAAAS
FT                   GDLTDSMRMFLMGVEGGKPADGGIGAQPEWFYKGDGRTLVHPGEDFAMPAFAEDGGEEP
FT                   EVAGIYLIDADGAPVRLGFALGNEFSDHVTERGNYLWLAHSKLRQAALGPELLLGDLPD
FT                   DLRGTSRIVRDGETVWERPFLSGEANMSHRIGNLEHHHFKYGLFRRPGDIHVHFFGTAT
FT                   LSFSDGFAAREGDVFEVEAAPFTLPVRNGLRRAADEGLARVKVL"
     MIRSLVQFEE GGRRGVAALD GTGAARRVEG ADSTRALALE AIAAGQGLAA MAEPRLGGTV        60
     DLSAVRLLCP IDHEDAAHLL VAGTGLTHLG SAEGRDKMHK AAASGDLTDS MRMFLMGVEG       120
     GKPADGGIGA QPEWFYKGDG RTLVHPGEDF AMPAFAEDGG EEPEVAGIYL IDADGAPVRL       180
     GFALGNEFSD HVTERGNYLW LAHSKLRQAA LGPELLLGDL PDDLRGTSRI VRDGETVWER       240
     PFLSGEANMS HRIGNLEHHH FKYGLFRRPG DIHVHFFGTA TLSFSDGFAA REGDVFEVEA       300
     APFTLPVRNG LRRAADEGLA RVKVL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page