(data stored in ACNUC7421 zone)

EMBL: AP010803.PE601

AP010803.PE601       Location/Qualifiers
FT   CDS             complement(612521..614584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06010"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95435"
FT                   /db_xref="GOA:D4YYK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK3"
FT                   /protein_id="BAI95435.1"
FT                   /translation="MDRLTEDNRLSGAPGIAEMIAAQGALGALTARIDAGSPLGPVNGW
FT                   SPALVSTVRLMLSSQAEIVLFWGPELCALYNEAYAPTIGDKHPRVLGRPAREGWTELWD
FT                   DLEPLLRSVIDRGQSVHAKDRPFYIERDGGQGEQVFFDINYSPVFEADGSVGGALCIVS
FT                   ETTKRVLAEKEMRADRARLWALARDPFLVADRDGTWLAASPAWTDILGWSEAELIGRTS
FT                   EWMEHPDDLEKTKGEIAGLARGTPTVRFENRFRAKDGSYRNFSWTAVPENDLIYCVARD
FT                   VTEQRAHARALAEAEEALRQAQKMETLGQLTGGVAHDFNNLLQIVTGNLELLQRGLNED
FT                   QARLRRAADNAMAGAERAALLTQRLLAFARRQPLAPERIDPNRLVSGMSDMLNRTLGET
FT                   IEVETIQSARIWPIEIDVNQMENALLNLAVNARDAMPDGGKLTIEVANTHIDEDYAAQE
FT                   AEVSPGQYVLISVSDTGEGMDEEVLSHAIEPFFTTKEVGRGTGLGLSMVYGFIKQSGGH
FT                   IRVYSESGHGTTVKIYLPRFYGPLPDNDTGVAERTAPVCGGDETVLVCEDDDKVRAYTV
FT                   DVLKELGYRVIEANDGAAALRALDAASQSIDLLFTDVILPGGMTGADIAQQARAQQPGL
FT                   KVLFATGYARNAIIHHGRLDPGVELLTKPFTYAELATKVRDMLDRDEARQVG"
     MDRLTEDNRL SGAPGIAEMI AAQGALGALT ARIDAGSPLG PVNGWSPALV STVRLMLSSQ        60
     AEIVLFWGPE LCALYNEAYA PTIGDKHPRV LGRPAREGWT ELWDDLEPLL RSVIDRGQSV       120
     HAKDRPFYIE RDGGQGEQVF FDINYSPVFE ADGSVGGALC IVSETTKRVL AEKEMRADRA       180
     RLWALARDPF LVADRDGTWL AASPAWTDIL GWSEAELIGR TSEWMEHPDD LEKTKGEIAG       240
     LARGTPTVRF ENRFRAKDGS YRNFSWTAVP ENDLIYCVAR DVTEQRAHAR ALAEAEEALR       300
     QAQKMETLGQ LTGGVAHDFN NLLQIVTGNL ELLQRGLNED QARLRRAADN AMAGAERAAL       360
     LTQRLLAFAR RQPLAPERID PNRLVSGMSD MLNRTLGETI EVETIQSARI WPIEIDVNQM       420
     ENALLNLAVN ARDAMPDGGK LTIEVANTHI DEDYAAQEAE VSPGQYVLIS VSDTGEGMDE       480
     EVLSHAIEPF FTTKEVGRGT GLGLSMVYGF IKQSGGHIRV YSESGHGTTV KIYLPRFYGP       540
     LPDNDTGVAE RTAPVCGGDE TVLVCEDDDK VRAYTVDVLK ELGYRVIEAN DGAAALRALD       600
     AASQSIDLLF TDVILPGGMT GADIAQQARA QQPGLKVLFA TGYARNAIIH HGRLDPGVEL       660
     LTKPFTYAEL ATKVRDMLDR DEARQVG                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page