(data stored in ACNUC7421 zone)

EMBL: AP010803.PE607

AP010803.PE607       Location/Qualifiers
FT   CDS             619501..620403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95441"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK9"
FT                   /protein_id="BAI95441.1"
FT                   /translation="MAMVLRALKLVPMVYQFSHSLGVWQGVVVSMCPHAPTSHKSSFCK
FT                   RLIATLENRKGTSARVTRLGNYLCSRKWMSAASLLLLTGLATSACSYVPQKYHYELIVK
FT                   VMRDGKSYVGSSVREVIVSRQGGALFSFMASKPYRARLIGEAVVVDLGELGHVFTLLRR
FT                   AEPGEGLVYDQGCTGDAVTNYIMNYHKKADCSQSPMESADFVKNIGRPILFSGPTTPTS
FT                   IILQNSDNPYSLKYLDNTFEVEMYISVTDKPYKHKISMLFPWIKNFMGRRFTYNPATGN
FT                   DYLLATIGGSEFISGGTGE"
     MAMVLRALKL VPMVYQFSHS LGVWQGVVVS MCPHAPTSHK SSFCKRLIAT LENRKGTSAR        60
     VTRLGNYLCS RKWMSAASLL LLTGLATSAC SYVPQKYHYE LIVKVMRDGK SYVGSSVREV       120
     IVSRQGGALF SFMASKPYRA RLIGEAVVVD LGELGHVFTL LRRAEPGEGL VYDQGCTGDA       180
     VTNYIMNYHK KADCSQSPME SADFVKNIGR PILFSGPTTP TSIILQNSDN PYSLKYLDNT       240
     FEVEMYISVT DKPYKHKISM LFPWIKNFMG RRFTYNPATG NDYLLATIGG SEFISGGTGE       300
//

If you have problems or comments...

PBIL Back to PBIL home page