(data stored in ACNUC7421 zone)

EMBL: AP010803.PE608

AP010803.PE608       Location/Qualifiers
FT   CDS             620396..623137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06080"
FT                   /product="RTX toxin"
FT                   /note="RTX toxin or related Ca2+-binding protein / possible
FT                   secreted protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95442"
FT                   /db_xref="GOA:D4YYL0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL0"
FT                   /protein_id="BAI95442.1"
FT                   /translation="MNNNLFLSILAMDAYNRGPGGHRIALNTVNGITQIGDAVILGTSD
FT                   PNDEVSTGFSAVSYSYNGDIIISYRGTDDTNIFDPSSDIWNGWSIGAGFIGNQAEQALD
FT                   YYTEVTGLSSTATASNVVLTGQSLGGGLAGFVSAVSGSNAVLFDHMPFLDAAATKVSNL
FT                   GTTGYTDRQFAYNVDGEALSALRLFGSTPSVEISMGSGFMVAGSELTSSSFPGSWYLHQ
FT                   PELMVIAMFGHTEIQDTDWQEAFYYITPTLFDHEVMDTMSGLDPDANDAIYYPYHNQQM
FT                   LGAIAYSSLDSGALIFGNTGIRALYNDASEFGRAIEAENQSQIDSFGEKMALSSMIVQF
FT                   SGEVSMNKIVDNNYIKEGILTVRNDGLGIVTSDKLWFSYGSLTPTTGVRLGFDVILGSS
FT                   LQEIGMSRDGNASIDDVSAWNAISGPLVDTGMANATAFGAYLFMSDNASAFHVGEGWAG
FT                   RLNDYDAIMTIGNSSANTIWGSSRDEVIFGNDGDDVIHGDEGNNYLHGGAGLDSAEYDA
FT                   EEEHVAFSMLGVEVFSQEHSDRLTSIEAINVHSDFFSLDVYDDIAADTDVSVNVAQTSH
FT                   AVINVSQAYSGMALTLSSGVGTLDDLSTEGSIALNGFVNLATVHGSGSDDQLSVSGSDN
FT                   SEVFGGDGHDVITGGLGVQNLYGDAGDDIIFGGGGNDYLDGGLGNDNLSGGDGADVIWG
FT                   GPEYDGYYDIDHLYGGSGDDIMHAGEAQSWVYGEEGDDQLYSGSSDAGFYLSGGQGNDQ
FT                   FFVNATDTEIVGGEGNDAYNFYGFFQPEDGVIVNLSGSFGHDVVESGSAVFDLAGYDRS
FT                   DLKYIWDAEVVSFDGEQYQMAGDLALVVKSTGDSILFRDVTGWRQGATSGVVRETWMAE
FT                   GYIDLDYHAFFEQGNYDGQLTVDGISLIDFYFGSTASYDVLA"
     MNNNLFLSIL AMDAYNRGPG GHRIALNTVN GITQIGDAVI LGTSDPNDEV STGFSAVSYS        60
     YNGDIIISYR GTDDTNIFDP SSDIWNGWSI GAGFIGNQAE QALDYYTEVT GLSSTATASN       120
     VVLTGQSLGG GLAGFVSAVS GSNAVLFDHM PFLDAAATKV SNLGTTGYTD RQFAYNVDGE       180
     ALSALRLFGS TPSVEISMGS GFMVAGSELT SSSFPGSWYL HQPELMVIAM FGHTEIQDTD       240
     WQEAFYYITP TLFDHEVMDT MSGLDPDAND AIYYPYHNQQ MLGAIAYSSL DSGALIFGNT       300
     GIRALYNDAS EFGRAIEAEN QSQIDSFGEK MALSSMIVQF SGEVSMNKIV DNNYIKEGIL       360
     TVRNDGLGIV TSDKLWFSYG SLTPTTGVRL GFDVILGSSL QEIGMSRDGN ASIDDVSAWN       420
     AISGPLVDTG MANATAFGAY LFMSDNASAF HVGEGWAGRL NDYDAIMTIG NSSANTIWGS       480
     SRDEVIFGND GDDVIHGDEG NNYLHGGAGL DSAEYDAEEE HVAFSMLGVE VFSQEHSDRL       540
     TSIEAINVHS DFFSLDVYDD IAADTDVSVN VAQTSHAVIN VSQAYSGMAL TLSSGVGTLD       600
     DLSTEGSIAL NGFVNLATVH GSGSDDQLSV SGSDNSEVFG GDGHDVITGG LGVQNLYGDA       660
     GDDIIFGGGG NDYLDGGLGN DNLSGGDGAD VIWGGPEYDG YYDIDHLYGG SGDDIMHAGE       720
     AQSWVYGEEG DDQLYSGSSD AGFYLSGGQG NDQFFVNATD TEIVGGEGND AYNFYGFFQP       780
     EDGVIVNLSG SFGHDVVESG SAVFDLAGYD RSDLKYIWDA EVVSFDGEQY QMAGDLALVV       840
     KSTGDSILFR DVTGWRQGAT SGVVRETWMA EGYIDLDYHA FFEQGNYDGQ LTVDGISLID       900
     FYFGSTASYD VLA                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page