(data stored in ACNUC7421 zone)

EMBL: AP010803.PE609

AP010803.PE609       Location/Qualifiers
FT   CDS             623207..624976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06090"
FT                   /product="ATP-binding cassette protein"
FT                   /note="subfamily C, bacterial / ABC-type protease / lipase
FT                   transport system, ATPase and permease component / ABC-type
FT                   multidrug/protein/lipid transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95443"
FT                   /db_xref="GOA:D4YYL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL1"
FT                   /protein_id="BAI95443.1"
FT                   /translation="MFQLIPQLRAKSMVATNSDMLRHAVQKARRHFGAVATFSALLNAL
FT                   YITPTLYMLQVYDRVVPTQGLQTLLYLTLVLIFALITLSLLDRLRLRLLIRAGVKLDMI
FT                   VAPALLDATLGRPDLPSARQGLRDFDTLRSTLSGPAILGLFDAPWVPVYLLVCFLVHPW
FT                   IGVLAVVGCLLLPLVAFTTWRATRHKLAQAQLLASVSYASQDELLAAADGIRALGMRRA
FT                   LVTRQLRQREAMIATQTQASLAAGSFLTLGKFIRLALQSLALGLGALLAVDNLISTGAI
FT                   FASSFLIARALQPIEQLIATWKSLIQARQQYTDIRTLLATAPAARIKTTLPPPKGKISV
FT                   ENLTVMNEARDGAVLQNISLAIPAGEVVAVVGPSGAGKSTLIRAIAGALLPDRGKIRLD
FT                   DADAQDWDPEILARHIGYLPQDSTLLAGSIADNIARFSTEWGEDRTCLDTDVVAAASKV
FT                   GADALIRRFPNGYDHQLKSGGKGISAGQAQRIALARAVFGDPAILLLDEPNAHLDTEGD
FT                   AALIAALGALKAERKTVLVVSHKLGILPVVDRILVMRDGHMEMFGPRDEVLAKITPPNM
FT                   RRVPAPSVAKAAS"
     MFQLIPQLRA KSMVATNSDM LRHAVQKARR HFGAVATFSA LLNALYITPT LYMLQVYDRV        60
     VPTQGLQTLL YLTLVLIFAL ITLSLLDRLR LRLLIRAGVK LDMIVAPALL DATLGRPDLP       120
     SARQGLRDFD TLRSTLSGPA ILGLFDAPWV PVYLLVCFLV HPWIGVLAVV GCLLLPLVAF       180
     TTWRATRHKL AQAQLLASVS YASQDELLAA ADGIRALGMR RALVTRQLRQ REAMIATQTQ       240
     ASLAAGSFLT LGKFIRLALQ SLALGLGALL AVDNLISTGA IFASSFLIAR ALQPIEQLIA       300
     TWKSLIQARQ QYTDIRTLLA TAPAARIKTT LPPPKGKISV ENLTVMNEAR DGAVLQNISL       360
     AIPAGEVVAV VGPSGAGKST LIRAIAGALL PDRGKIRLDD ADAQDWDPEI LARHIGYLPQ       420
     DSTLLAGSIA DNIARFSTEW GEDRTCLDTD VVAAASKVGA DALIRRFPNG YDHQLKSGGK       480
     GISAGQAQRI ALARAVFGDP AILLLDEPNA HLDTEGDAAL IAALGALKAE RKTVLVVSHK       540
     LGILPVVDRI LVMRDGHMEM FGPRDEVLAK ITPPNMRRVP APSVAKAAS                   589
//

If you have problems or comments...

PBIL Back to PBIL home page