(data stored in ACNUC7421 zone)

EMBL: AP010803.PE61

AP010803.PE61        Location/Qualifiers
FT   CDS             complement(58416..60341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00610"
FT                   /product="trypsin-like serine protease"
FT                   /note="putative protease with the C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94895"
FT                   /db_xref="GOA:D4YX13"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX13"
FT                   /protein_id="BAI94895.1"
FT                   /translation="MFMIRSLAAALFLSTAISGPLIAQDAIRSRPVALPVDNAAPTPKD
FT                   VPYPGGTIRLEVDATDTVQRIFRVKETIPVAAAGPMTLLMPQWLPGNHAPRGQIEKLTG
FT                   LTFTADGKPLAWKRDPLNVFGFVIDVPQGVKQVVASFQFLSATQPNQGRVVVTPKMLNI
FT                   QWESVSLYPAGYYTRAIPIQATVTYPDGWQAATALRGKKTGSTVAYETIDYEALQDSPV
FT                   FAGLYFKPVDLGHNVTLNILADDAGELDAKPDQIAKHKKLVDEAGALFGAYHFDHYDFL
FT                   FAITDEMGGIGLEHHRSSENQVEPGYFKKWGDGAALLDRNLLPHEFTHSWDGKFRRPDL
FT                   LWTPDFNVPMQDNLLWVYEGQTQFWGYVLGARSGLFSKQETLDAYAHIAAKLDTARGRE
FT                   WRPMEDTTHDPIISARRPKGWSSWQRSEDYYNEGLMIWLEADAIIRQQTSGAKGLDDFA
FT                   RAFFGTHPGDWGQVVYNRGDVIRTLNQVAPYDWAGFFQKYVDGTTKETPKGGFTLGGYR
FT                   LVYGDTPGAITKAAEGSGKFTDQSFGIGLIVKNDGEISNVVWDSPAFKAGLAIGSKIVA
FT                   INGDEYSGDVFKAAIKSGKPLQIILKQDKYYRTLSLAYSGGLRYPRLEKMGEGEGSLDR
FT                   LLKPKT"
     MFMIRSLAAA LFLSTAISGP LIAQDAIRSR PVALPVDNAA PTPKDVPYPG GTIRLEVDAT        60
     DTVQRIFRVK ETIPVAAAGP MTLLMPQWLP GNHAPRGQIE KLTGLTFTAD GKPLAWKRDP       120
     LNVFGFVIDV PQGVKQVVAS FQFLSATQPN QGRVVVTPKM LNIQWESVSL YPAGYYTRAI       180
     PIQATVTYPD GWQAATALRG KKTGSTVAYE TIDYEALQDS PVFAGLYFKP VDLGHNVTLN       240
     ILADDAGELD AKPDQIAKHK KLVDEAGALF GAYHFDHYDF LFAITDEMGG IGLEHHRSSE       300
     NQVEPGYFKK WGDGAALLDR NLLPHEFTHS WDGKFRRPDL LWTPDFNVPM QDNLLWVYEG       360
     QTQFWGYVLG ARSGLFSKQE TLDAYAHIAA KLDTARGREW RPMEDTTHDP IISARRPKGW       420
     SSWQRSEDYY NEGLMIWLEA DAIIRQQTSG AKGLDDFARA FFGTHPGDWG QVVYNRGDVI       480
     RTLNQVAPYD WAGFFQKYVD GTTKETPKGG FTLGGYRLVY GDTPGAITKA AEGSGKFTDQ       540
     SFGIGLIVKN DGEISNVVWD SPAFKAGLAI GSKIVAINGD EYSGDVFKAA IKSGKPLQII       600
     LKQDKYYRTL SLAYSGGLRY PRLEKMGEGE GSLDRLLKPK T                           641
//

If you have problems or comments...

PBIL Back to PBIL home page