(data stored in ACNUC7421 zone)

EMBL: AP010803.PE610

AP010803.PE610       Location/Qualifiers
FT   CDS             624973..626331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06100"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95444"
FT                   /db_xref="GOA:D4YYL2"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL2"
FT                   /protein_id="BAI95444.1"
FT                   /translation="MSQQIVLPALRPEVDLAVIADPKRDIRQGLIIAILFFAGFLGWTA
FT                   FSRLDAAAYATGRLIVAGQRQSVQHRDGGVVGSIHVREGQRVERGRLLMTLAAAEVQAQ
FT                   ERALASQAIRLLAQRARLEAEQMGLSQINEPQEFLSLQPRDRADAALAMKLQRAELQAR
FT                   VAVLAAQRDALQQQVVQSGEQGRGYNEQAVSTREQLRLIDEQIAALRPVAEKGFVSKTR
FT                   MRELERMRASLEGQRGQYNASVAQTRGAVRENEIQVLEAERSFRERTASELRDVELRLG
FT                   DVLPKWRAARDQLARTEIRAPATGAIVGLTVFTPGGVISPGQKLMDIIPERQPLRIQMQ
FT                   ISPDDADDLQMGQKLLVKFSGLHERTLPNLEGELTRLSADSFIDERSGQSYFTGEAAVP
FT                   LSQLQLIRKVRGEDFALRAGMPVQVLIPLRKRSALDYALEPLIGSFWSSFREH"
     MSQQIVLPAL RPEVDLAVIA DPKRDIRQGL IIAILFFAGF LGWTAFSRLD AAAYATGRLI        60
     VAGQRQSVQH RDGGVVGSIH VREGQRVERG RLLMTLAAAE VQAQERALAS QAIRLLAQRA       120
     RLEAEQMGLS QINEPQEFLS LQPRDRADAA LAMKLQRAEL QARVAVLAAQ RDALQQQVVQ       180
     SGEQGRGYNE QAVSTREQLR LIDEQIAALR PVAEKGFVSK TRMRELERMR ASLEGQRGQY       240
     NASVAQTRGA VRENEIQVLE AERSFRERTA SELRDVELRL GDVLPKWRAA RDQLARTEIR       300
     APATGAIVGL TVFTPGGVIS PGQKLMDIIP ERQPLRIQMQ ISPDDADDLQ MGQKLLVKFS       360
     GLHERTLPNL EGELTRLSAD SFIDERSGQS YFTGEAAVPL SQLQLIRKVR GEDFALRAGM       420
     PVQVLIPLRK RSALDYALEP LIGSFWSSFR EH                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page