(data stored in ACNUC7421 zone)

EMBL: AP010803.PE611

AP010803.PE611       Location/Qualifiers
FT   CDS             complement(626744..627286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06110"
FT                   /product="invertase/recombinase like protein"
FT                   /note="site-specific recombinase, DNA invertase Pin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95445"
FT                   /db_xref="GOA:D4YYL3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL3"
FT                   /protein_id="BAI95445.1"
FT                   /translation="MIVGYARVSTTDQCLAVQMDELAAHGCDRIFQDQASGTSRARAGL
FT                   VEMMQFVREGDTIVVSRLDRFARSLTDLFQLLDELSRKGVAFQCVHQSIDTSSSTGKLT
FT                   LAILGAVAEFENDIRRERQRAGIAKAKANGVYKGRRAKINAERVREMAAQGFTASTIAS
FT                   ELGCHRQSAYRLLRTAS"
     MIVGYARVST TDQCLAVQMD ELAAHGCDRI FQDQASGTSR ARAGLVEMMQ FVREGDTIVV        60
     SRLDRFARSL TDLFQLLDEL SRKGVAFQCV HQSIDTSSST GKLTLAILGA VAEFENDIRR       120
     ERQRAGIAKA KANGVYKGRR AKINAERVRE MAAQGFTAST IASELGCHRQ SAYRLLRTAS       180
//

If you have problems or comments...

PBIL Back to PBIL home page